A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10935
Swiss-prot Accession number	P11280 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Mustela vison (American mink) (Neovison vison)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae;Mustelinae; Neovison.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	ACTH stimulates the adrenal glands to release cortisol
Protein Length	142 Amino acids
Molecular weight	15822
References	1  PubMed abstract 3397057 2  PubMed abstract 3382437 3  PubMed abstract 3397057 4  PubMed abstract 3382437
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Corticotropin
Mature Hormone Sequence	SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Position of mature hormone in Pre-Hormone protein	39 Residues from position (11-49)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10936
Swiss-prot Accession number	P11280 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Mustela vison (American mink) (Neovison vison)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae;Mustelinae; Neovison.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	142 Amino acids
Molecular weight	15822
References	1  PubMed abstract 3397057 2  PubMed abstract 3382437 3  PubMed abstract 3397057 4  PubMed abstract 3382437
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin alpha (Alpha-MSH)
Mature Hormone Sequence	SYSMEHFRWGKPV
Position of mature hormone in Pre-Hormone protein	13 Residues from position (11-23)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10937
Swiss-prot Accession number	P11280 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Mustela vison (American mink) (Neovison vison)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae;Mustelinae; Neovison.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	142 Amino acids
Molecular weight	15822
References	1  PubMed abstract 3397057 2  PubMed abstract 3382437 3  PubMed abstract 3397057 4  PubMed abstract 3382437
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Lipotropin beta (Beta-LPH)
Mature Hormone Sequence	ELAGERPEPALGPEGAAEGMAALADLEYGLVAKAEVAEKKDDGPYKMEHFRWGSPGKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
Position of mature hormone in Pre-Hormone protein	91 Residues from position (52-142)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10938
Swiss-prot Accession number	P11280 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Mustela vison (American mink) (Neovison vison)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae;Mustelinae; Neovison.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	142 Amino acids
Molecular weight	15822
References	1  PubMed abstract 3397057 2  PubMed abstract 3382437 3  PubMed abstract 3397057 4  PubMed abstract 3382437
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Lipotropin gamma (Gamma-LPH)
Mature Hormone Sequence	ELAGERPEPALGPEGAAEGMAALADLEYGLVAKAEVAEKKDDGPYKMEHFRWGSPGKD
Position of mature hormone in Pre-Hormone protein	58 Residues from position (52-109)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10939
Swiss-prot Accession number	P11280 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Mustela vison (American mink) (Neovison vison)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae;Mustelinae; Neovison.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	142 Amino acids
Molecular weight	15822
References	1  PubMed abstract 3397057 2  PubMed abstract 3382437 3  PubMed abstract 3397057 4  PubMed abstract 3382437
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin beta (Beta-MSH)
Mature Hormone Sequence	DDGPYKMEHFRWGSPGKD
Position of mature hormone in Pre-Hormone protein	18 Residues from position (92-109)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	10940
Swiss-prot Accession number	P11280 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Mustela vison (American mink) (Neovison vison)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae;Mustelinae; Neovison.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Beta-endorphin is an endogenous peptide
Protein Length	142 Amino acids
Molecular weight	15822
References	1  PubMed abstract 3397057 2  PubMed abstract 3382437 3  PubMed abstract 3397057 4  PubMed abstract 3382437
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Beta-endorphin
Mature Hormone Sequence	YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
Position of mature hormone in Pre-Hormone protein	31 Residues from position (112-142)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	10941
Swiss-prot Accession number	P11280 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Mustela vison (American mink) (Neovison vison)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae;Mustelinae; Neovison.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Met-enkephalin is an endogenous peptide
Protein Length	142 Amino acids
Molecular weight	15822
References	1  PubMed abstract 3397057 2  PubMed abstract 3382437 3  PubMed abstract 3397057 4  PubMed abstract 3382437
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Met-enkephalin
Mature Hormone Sequence	YGGFM
Position of mature hormone in Pre-Hormone protein	5 Residues from position (112-116)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	11022
Swiss-prot Accession number	P29234 (Sequence in FASTA format)
Description	Prolactin precursor (PRL).
Source organism	Mustela vison (American mink) (Neovison vison)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae;Mustelinae; Neovison.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Prolactin acts primarily on the mammary gland by promoting lactation
Protein Length	229 Amino acids
Molecular weight	26194
References	1   Vardy T.L., Farid A.; "Nucleotide sequence variation of the mink preprolactin gene."; Submitted (MAR-2003) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 8307350 3   Bondar A.A., Golovin S.J., Mertvetsov N.P.; "Nucleotide sequence of mink prolactin mRNA from pituitary."; Sibirskii Biol. Zh. 2:10-15(1993).
Domain Name	Hormone_1
Hormone Name	Prolactin
Mature Hormone Sequence	LPICPTGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEDLLNLILRVLRSWNDPLYHLVSEVRGMQEAPDSILSRAIEIEEQNRRLLEGMEKIVGQVHPGVRENEVYSVWSGLPSLQMADEDSRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIVYDSNC
Position of mature hormone in Pre-Hormone protein	199 Residues from position (31-229)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 9

HMRbase accession number	11559
Swiss-prot Accession number	B3VKT4 (Sequence in FASTA format)
Description	Putative leptin
Source organism	Mustela vison (American mink) (Neovison vison)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae;Mustelinae; Neovison.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	N/A
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	166 Amino acids
Molecular weight	18419
References	----
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated